Home > Chemical, Plastic, Rubber & Environmental Conservation > Chemical Products > Other Chemical Products

Haven't found any supplier?

Tell us what you are looking for, and we will search for you.

  • Product Name *
  • Description / Spec. of the product *
  • Relevant Keywords*

    separate with commas.
  • Your Name*
  • Your Company URL

  • Your e-mail*
  • Verification Code*
  
Recommended Other Chemical Products manufacturers and suppliers.
select Click to select items, then click send inquiry
Qualified Other Chemical Products Manufacturer and Supplier

Other Chemical Products - Seih-Ying Co., Ltd.goldGold Supplier

Since it establishment in 1990, Seih-Ying Co., Ltd. has always strived in research and production on optical and special glass. Among our products, t... More

Main Products: Road stud,360 cat eye, Tiger eye, Siglite,360 Road Marking Reflector, 360 glass road stud, traffic safety, road safety, Filter, UV-Filter, IR-Filter... More
Qualified Other Chemical Products Manufacturer and Supplier

Other Chemical Products - s񦳭qgoldGold Supplier

Grema machinery Co., Ltd. was established in 1989 with factory located at center area of Taiwan. We specialize in design and manufacturing of various ... More

Main Products: Fully automatic pulverizing conveying production line. Fully automatic negative-pressure conveying production line. Power filtration tank... More
Qualified Other Chemical Products Manufacturer and Supplier

Other Chemical Products - Ding Hwa Co., Ltd.goldGold Supplier

Ding Hwa is a Taiwan based supplier who specializes in efficient and powerful airbrush equipment, air compressors, aspirator products, and vacuum pump... More

Main Products: Air Compressors, Vacuum Pumps, Airbrushes, Airbrush Makeup Systems, Airbrush Equipment... More
More suppliers
Product Search Results for Other Chemical Products
select Click to select items, then click send inquiry
Cinnamonitrile - 1885-38-7

Cinnamonitrile - 1885-38-7

【Main components】Cinnamonitrile【Other name】(E) -3 - phenyl -2-acrylonitrile, Styryl nitrile, Beta- Triphenylacrylonitrile【Products ... More

Hubei Yuancheng Pharmaceutical Co., Ltd.
Main Products: Cinnamic acid ,3-Hydroxycinnamic acid... More
Send Inquiry for Cinnamonitrile - 1885-38-7
  
Linkers for Solid Phase Synthesis - biochemicals

Linkers for Solid Phase Synthesis - biochemicals

HMBA Linker、HMPLinker、Rink Amide Linker ... More

Suzhou Highfine Biotech Co.,Ltd.
Main Products: Peptide Coupling Reagents... More
Send Inquiry for Linkers for Solid Phase Synthesis - biochemicals
  
Magic Composites - 012

Magic Composites - 012

Magic Composites, Inc. is a manufacturer of fiberglass reinforced plastics (FRP) equipment with the ability to produce high quality engineered process vessels, chemical ... More

Shenzhen Hongke Electronics Co., Ltd
Main Products: CCTV cable, HDMI cable, DVI cable, SATA cable, USB cable... More
Send Inquiry for Magic Composites - 012
  
Glucoamylase,Medium temperature alpha-Amylase - Enzyme

Glucoamylase,Medium temperature alpha-Amylase - Enzyme

Wuxi Green Year Union Works Co.,Ltd is a high-tech enterprise with an integration of research&development, producing and trading.We are committed to providing the best value ... More

WuXi Green Year Co. LTD
Main Products: Saccharifying enzyme, high temperature resistant a amylase... More
Send Inquiry for Glucoamylase,Medium temperature alpha-Amylase - Enzyme
  
Swimming Fool Electrolyser for Swimming Pool, Drinking Water Systems, Coastal Installation - Chlorinator,Electrod

Swimming Fool Electrolyser for Swimming Pool, Drinking Water Systems, Coastal Installation - Chlorinator,Electrod

Swimming pool Electrolyzer for Swimming pool, ... More

Ti Anode Fabricators Pvt. Ltd.
Main Products: Electrolyzer for electrochlorinator... More
Send Inquiry for Swimming Fool Electrolyser for Swimming Pool, Drinking Water Systems, Coastal Installation - Chlorinator,Electrod
  
Green Tire Inside Paint - RE-1000GTI

Green Tire Inside Paint - RE-1000GTI

DescriptionRE-1000GTI is a green tire inner liner paint formulated to serve as a release agent during the curing process. The aqueous dispersions are silicone emulsion-based ... More

Global Fine Chemicals (Shanghai) Co. Ltd.
Main Products: Tire Release Agent and Marking Paint... More
Send Inquiry for Green Tire Inside Paint - RE-1000GTI
  
Solvent Tire Marking Paint - HL-S SERIES

Solvent Tire Marking Paint - HL-S SERIES

DescriptionHL-S Series is a solvent-based marking paint used for identification on green tread rubber surfaces after the extrusion and before the curing process. The HL-S ... More

Global Fine Chemicals (Shanghai) Co. Ltd.
Main Products: Tire Release Agent and Marking Paint... More
Send Inquiry for Solvent Tire Marking Paint - HL-S SERIES
  
ADWX-1 - MPK-001

ADWX-1 - MPK-001

Sequence: VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK [Disulfide Bridges: 7-27, 13-32, 17-34]Molecular Weight: 4072 DaDescription:Voltage-gated channel ... More

Wuhan More Biotechnology Co.,Ltd.
Main Products: Customized peptide, Gene engineering,API,Ion Channel... More
Send Inquiry for ADWX-1 - MPK-001
  
customized peptide - peptide

customized peptide - peptide

More Biotech’s featured customized gene engineering (recombinant) peptide service is suitable for those target peptides with certain amount of residues (> 50 aa) or ... More

Wuhan More Biotechnology Co.,Ltd.
Main Products: Customized peptide, Gene engineering,API,Ion Channel... More
Send Inquiry for customized peptide - peptide
  
select Click to select items, then click send inquiry