Home > Chemical, Plastic, Rubber & Environmental Conservation > Chemical Products > Other Chemical Products

Hot Products

alternator pulley

alternator pulley

hydraulic tensioner

hydraulic tensioner

wheel bearing hub

wheel bearing hub

Endoscope

Endoscope

Refractometer

Refractometer

Tool chest

Tool chest

Haven't found any supplier?

Tell us what you are looking for, and we will search for you.

  • Product Name *
  • Description / Spec. of the product *
  • Relevant Keywords*

    separate with commas.
  • Your Name*
  • Your Company URL

  • Your e-mail*
  • Verification Code*
  

Related Keywords

Recommended Other Chemical Products manufacturers and suppliers.
Select All | Clear All
select Click to select items, then click send inquiry
Qualified Other Chemical Products Manufacturer and Supplier

Other Chemical Products - Seih-Ying Co., Ltd.goldGold Supplier

Since it establishment in 1990, Seih-Ying Co., Ltd. has always strived in research and production on optical and special glass. Among our products, t... More

Main Products: Road stud,360 cat eye, Tiger eye, Siglite,360 Road Marking Reflector, 360 glass road stud, traffic safety, road safety, Filter, UV-Filter, IR-Filter... More
Qualified Other Chemical Products Manufacturer and Supplier

Other Chemical Products - s񦳭qgoldGold Supplier

Grema machinery Co., Ltd. was established in 1989 with factory located at center area of Taiwan. We specialize in design and manufacturing of various ... More

Main Products: Fully automatic pulverizing conveying production line. Fully automatic negative-pressure conveying production line. Power filtration tank... More
Qualified Other Chemical Products Manufacturer and Supplier

Other Chemical Products - Ding Hwa Co., Ltd.goldGold Supplier

Ding Hwa is a Taiwan based supplier who specializes in efficient and powerful airbrush equipment, air compressors, aspirator products, and vacuum pump... More

Main Products: Air Compressors, Vacuum Pumps, Airbrushes, Airbrush Makeup Systems, Airbrush Equipment... More
More suppliers
Product Search Results for Other Chemical Products
Select All | Clear All
select Click to select items, then click send inquiry
Cinnamonitrile - 1885-38-7

Cinnamonitrile - 1885-38-7

【Main components】Cinnamonitrile【Other name】(E) -3 - phenyl -2-acrylonitrile, Styryl nitrile, Beta- Triphenylacrylonitrile【Products ... More

Hubei Yuancheng Pharmaceutical Co., Ltd.
Main Products: Cinnamic acid ,3-Hydroxycinnamic acid... More
Send Inquiry for Cinnamonitrile - 1885-38-7
  
Linkers for Solid Phase Synthesis - biochemicals

Linkers for Solid Phase Synthesis - biochemicals

HMBA Linker、HMPLinker、Rink Amide Linker ... More

Suzhou Highfine Biotech Co.,Ltd.
Main Products: Peptide Coupling Reagents... More
Send Inquiry for Linkers for Solid Phase Synthesis - biochemicals
  
Magic Composites - 012

Magic Composites - 012

Magic Composites, Inc. is a manufacturer of fiberglass reinforced plastics (FRP) equipment with the ability to produce high quality engineered process vessels, chemical ... More

Shenzhen Hongke Electronics Co., Ltd
Main Products: CCTV cable, HDMI cable, DVI cable, SATA cable, USB cable... More
Send Inquiry for Magic Composites - 012
  
Glucoamylase,Medium temperature alpha-Amylase - Enzyme

Glucoamylase,Medium temperature alpha-Amylase - Enzyme

Wuxi Green Year Union Works Co.,Ltd is a high-tech enterprise with an integration of research&development, producing and trading.We are committed to providing the best value ... More

WuXi Green Year Co. LTD
Main Products: Saccharifying enzyme, high temperature resistant a amylase... More
Send Inquiry for Glucoamylase,Medium temperature alpha-Amylase - Enzyme
  
Swimming Fool Electrolyser for Swimming Pool, Drinking Water Systems, Coastal Installation - Chlorinator,Electrod

Swimming Fool Electrolyser for Swimming Pool, Drinking Water Systems, Coastal Installation - Chlorinator,Electrod

Swimming pool Electrolyzer for Swimming pool, ... More

Ti Anode Fabricators Pvt. Ltd.
Main Products: Electrolyzer for electrochlorinator... More
Send Inquiry for Swimming Fool Electrolyser for Swimming Pool, Drinking Water Systems, Coastal Installation - Chlorinator,Electrod
  
Daiki Electrolyser for Power Station Coastal Installation, Fire water system, Marine Vessels - Electrolyser,Chlorin

Daiki Electrolyser for Power Station Coastal Installation, Fire water system, Marine Vessels - Electrolyser,Chlorin

Daiki Electrolyser Power Stations, ... More

Ti Anode Fabricators Pvt. Ltd.
Main Products: Electrolyzer for electrochlorinator... More
Send Inquiry for Daiki Electrolyser for Power Station Coastal Installation, Fire water system, Marine Vessels - Electrolyser,Chlorin
  
Green Tire Inside Paint - RE-1000GTI

Green Tire Inside Paint - RE-1000GTI

DescriptionRE-1000GTI is a green tire inner liner paint formulated to serve as a release agent during the curing process. The aqueous dispersions are silicone emulsion-based ... More

Global Fine Chemicals (Shanghai) Co. Ltd.
Main Products: Tire Release Agent and Marking Paint... More
Send Inquiry for Green Tire Inside Paint - RE-1000GTI
  
Solvent Tire Marking Paint - HL-S SERIES

Solvent Tire Marking Paint - HL-S SERIES

DescriptionHL-S Series is a solvent-based marking paint used for identification on green tread rubber surfaces after the extrusion and before the curing process. The HL-S ... More

Global Fine Chemicals (Shanghai) Co. Ltd.
Main Products: Tire Release Agent and Marking Paint... More
Send Inquiry for Solvent Tire Marking Paint - HL-S SERIES
  
ADWX-1 - MPK-001

ADWX-1 - MPK-001

Sequence: VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK [Disulfide Bridges: 7-27, 13-32, 17-34]Molecular Weight: 4072 DaDescription:Voltage-gated channel ... More

Wuhan More Biotechnology Co.,Ltd.
Main Products: Customized peptide, Gene engineering,API,Ion Channel... More
Send Inquiry for ADWX-1 - MPK-001
  
customized peptide - peptide

customized peptide - peptide

More Biotech’s featured customized gene engineering (recombinant) peptide service is suitable for those target peptides with certain amount of residues (> 50 aa) or ... More

Wuhan More Biotechnology Co.,Ltd.
Main Products: Customized peptide, Gene engineering,API,Ion Channel... More
Send Inquiry for customized peptide - peptide
  
Select All | Clear All
select Click to select items, then click send inquiry
Home | Hot Search | Trade Leads | Press Rrelease| Submit Products™
About Us | Link Exchange | Legal Policy | Privacy Policy |Join Us | User Guide
Our Partners: 3cmakers | IAMakers | SportMakers
Copyright © 1996-2012 All Products Online Corp. All rights reserved