Sequence: ECRYWLGGCSAGQTCCKHLVCSRRHGWCVWDGTFS
Description:
Native ProTx-I has been isolated from the venom of the tarantula Thrixopelma pruriens. It was purified on the basis of its ability to reversibly inhibit the tetrodotoxin (TTX)-resistant Na channel Nav1.8. Structurally, ProTx-I is shown to belong to the inhibitory cystine knot (ICK) family of peptidyl toxins interacting with voltage-gated ion channels. ProTx-I was also found to be an inhibitor for TTX sensitive Nav channels such Nav1.5, Nav1.7 and Nav1.3 with IC50 values below 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of Cav 3.1 a(1G), (IC50 ~50 nM) without affecting the voltage dependence of inactivation.
M.W.: 3987.5 Da.
Purity: ≥98% (HPLC)
Form: lyophilized powder:
Storage temp .: −20°C
Description:
Native ProTx-I has been isolated from the venom of the tarantula Thrixopelma pruriens. It was purified on the basis of its ability to reversibly inhibit the tetrodotoxin (TTX)-resistant Na channel Nav1.8. Structurally, ProTx-I is shown to belong to the inhibitory cystine knot (ICK) family of peptidyl toxins interacting with voltage-gated ion channels. ProTx-I was also found to be an inhibitor for TTX sensitive Nav channels such Nav1.5, Nav1.7 and Nav1.3 with IC50 values below 100 nM. Furthermore, ProTx-I shifts the voltage dependence activity of Cav 3.1 a(1G), (IC50 ~50 nM) without affecting the voltage dependence of inactivation.
M.W.: 3987.5 Da.
Purity: ≥98% (HPLC)
Form: lyophilized powder:
Storage temp .: −20°C
Main Products
Customized peptide, Gene engineering,API,Ion Channel.